beta 2 Defensin Antikörper (AA 4-41)

Produktnummer ABIN234970

Produktdetails anti-beta 2 Defensin Antikörper

Target: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Bindungsspezifität: AA 4-41

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser beta 2 Defensin Antikörper ist unkonjugiert

Applikation: ELISA

Spezifität: Synthetic human beta-Defensin 2 (AA 4-41)

Produktmerkmale: MAb to beta-Defensin-2 (AA 4-41), Monoclonal antibody to Human beta-Defensin-2 (AA 4-41), Cell culture supernatant

Aufreinigung: Protein L. Cell culture

Immunogen: Synthetic human beta-Defensin 2 (AA 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)

Klon: L12-4C-C2

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Reconstitute in 10 µL double distilled water.

Buffer: Lyophilized from 50 mM Tris, pH 7.4.

Konservierungsmittel: Without preservative

Handhabung: Avoid multiple freeze/thaw cycles.
Centrifuge product if not completely clear after standing at room temperature.
Prepare working dilution only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized product at 2-8 °C. After reconstitution, store at -28 °C.

Details zu beta 2 Defensin

Target: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Andere Bezeichnung: Beta-Defensin-2 (BD-2 Produkte)

Synonyme: BD-2 antikoerper, BD-4 antikoerper, DEFB-4 antikoerper, hBD-4 antikoerper, BD2 antikoerper, DEFB2 antikoerper, defensin beta 2 antikoerper, defensin beta 104B antikoerper, beta defensin 2 antikoerper, Defb2 antikoerper, DEFB104B antikoerper, SBD2 antikoerper