beta 2 Defensin Antikörper (AA 4-41)
-
- Target Alle beta 2 Defensin (BD-2) Antikörper anzeigen
- beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))
-
Bindungsspezifität
- AA 4-41
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser beta 2 Defensin Antikörper ist unkonjugiert
-
Applikation
- ELISA
- Spezifität
- Synthetic human beta-Defensin 2 (AA 4-41)
- Produktmerkmale
- MAb to beta-Defensin-2 (AA 4-41), Monoclonal antibody to Human beta-Defensin-2 (AA 4-41), Cell culture supernatant
- Aufreinigung
- Protein L. Cell culture
- Immunogen
- Synthetic human beta-Defensin 2 (AA 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
- Klon
- L12-4C-C2
- Isotyp
- IgG1
- Top Product
- Discover our top product BD-2 Primärantikörper
-
-
- Applikationshinweise
- Suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Reconstitute in 10 µL double distilled water.
- Buffer
- Lyophilized from 50 mM Tris, pH 7.4.
- Konservierungsmittel
- Without preservative
- Handhabung
-
Avoid multiple freeze/thaw cycles.
Centrifuge product if not completely clear after standing at room temperature.
Prepare working dilution only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store lyophilized product at 2-8 °C. After reconstitution, store at -28 °C.
-
- Target
- beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))
- Andere Bezeichnung
- Beta-Defensin-2 (BD-2 Produkte)
-