Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

beta 2 Defensin Antikörper (AA 4-41)

Dieses Maus Monoklonal-Antikörper erkennt spezifisch beta 2 Defensin in ELISA. Er zeigt eine Reaktivität gegenüber Human.
Produktnummer ABIN234970

Kurzübersicht für beta 2 Defensin Antikörper (AA 4-41) (ABIN234970)

Target

Alle beta 2 Defensin (BD-2) Antikörper anzeigen
beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Reaktivität

  • 36
  • 32
  • 18
  • 5
  • 2
  • 2
  • 1
Human

Wirt

  • 62
  • 13
  • 4
  • 2
Maus

Klonalität

  • 67
  • 13
Monoklonal

Konjugat

  • 30
  • 7
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
Dieser beta 2 Defensin Antikörper ist unkonjugiert

Applikation

  • 43
  • 39
  • 39
  • 20
  • 17
  • 16
  • 13
  • 12
  • 10
  • 5
  • 4
  • 1
  • 1
ELISA

Klon

L12-4C-C2
  • Bindungsspezifität

    • 32
    • 17
    • 9
    • 2
    • 1
    AA 4-41

    Spezifität

    Synthetic human beta-Defensin 2 (AA 4-41)

    Produktmerkmale

    MAb to beta-Defensin-2 (AA 4-41), Monoclonal antibody to Human beta-Defensin-2 (AA 4-41), Cell culture supernatant

    Aufreinigung

    Protein L. Cell culture

    Immunogen

    Synthetic human beta-Defensin 2 (AA 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)

    Isotyp

    IgG1
  • Applikationshinweise

    Suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Reconstitute in 10 µL double distilled water.

    Buffer

    Lyophilized from 50 mM Tris, pH 7.4.

    Konservierungsmittel

    Without preservative

    Handhabung

    Avoid multiple freeze/thaw cycles.
    Centrifuge product if not completely clear after standing at room temperature.
    Prepare working dilution only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store lyophilized product at 2-8 °C. After reconstitution, store at -28 °C.
  • Target

    beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

    Andere Bezeichnung

    Beta-Defensin-2
Sie sind hier:
Chat with us!