Integrin alpha 3b Antikörper (N-Term)

Produktnummer ABIN2295556

Dieses Maus Monoklonal-Antikörper erkennt spezifisch Integrin alpha 3b in IHC, WB und IC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Integrin alpha 3b Antikörper (N-Term) (ABIN2295556)

Target: Integrin alpha 3b

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3b Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Klon: 54B3

Produktdetails anti-Integrin alpha 3b Antikörper

Bindungsspezifität: N-Term

Sequenz: CTRYYQIMPK YHAVRIREEE RYPPPGSTLP TKK

Kreuzreaktivität: Human

Kreuzreaktivität (Details): Calculated cross reactivity: Hu

Produktmerkmale: Integrin alpha 3B

Aufreinigung: Purified by Protein G affinity chromatography.

Immunogen: Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal working conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu Integrin alpha 3b

Target: Integrin alpha 3b