IL-21 Antikörper (N-Term)
-
- Target Alle IL-21 (IL21) Antikörper anzeigen
- IL-21 (IL21) (Interleukin 21 (IL21))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Maus
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL-21 Antikörper ist unkonjugiert
-
Applikation
- ELISA, Immunochromatography (IC)
- Sequenz
- CRHLIDIVEQ LKIYENDLDP ELLSAPQDVK
- Kreuzreaktivität
- Maus
- Kreuzreaktivität (Details)
- Calculated cross reactivity: Mo
- Produktmerkmale
- Interleukin 21 (IL-21), NT
- Aufreinigung
- Purified by immunoaffinity chromatography.
- Immunogen
- Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21.
- Isotyp
- IgG
- Top Product
- Discover our top product IL21 Primärantikörper
-
anti-Interleukin 21 (IL21) (AA 25-162) antibody
IL21 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 (IL21) (AA 1-162) antibodyIL21 Reaktivität: Human WB, PLA Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 (IL21) (AA 25-146) antibodyIL21 Reaktivität: Maus WB, IHC, ICC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 (IL21) (AA 25-162) antibodyIL21 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 (IL21) (AA 65-155) antibodyIL21 Reaktivität: Human, Maus WB, ELISA, IF (p), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 (IL21) (AA 104-132), (C-Term) antibodyIL21 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB33749 unconjugated
anti-Interleukin 21 (IL21) (AA 23-155) antibodyIL21 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 (IL21) antibodyIL21 Reaktivität: Human, Ratte WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 (IL21) (AA 1-146) antibodyIL21 Reaktivität: Ratte WB, IHC, ICC, IP Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal working conditions should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide before the addition of 40 % glycerol.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- -20°C
-
- Target
- IL-21 (IL21) (Interleukin 21 (IL21))
- Andere Bezeichnung
- Interleukin 21 (IL21 Produkte)
- Synonyme
- IL-21 antikoerper, Za11 antikoerper, interleukin 21 antikoerper, IL21 antikoerper, Il21 antikoerper
- Pathways
- JAK-STAT Signalweg, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response
-
