IL-21 Antikörper (N-Term)

Produktnummer ABIN2288617

Dieses Ziege Polyklonal-Antikörper erkennt spezifisch IL-21 in ELISA und IC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für IL-21 Antikörper (N-Term) (ABIN2288617)

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser IL-21 Antikörper ist unkonjugiert

Applikation: ELISA, Immunochromatography (IC)

Produktdetails anti-IL-21 Antikörper

Bindungsspezifität: N-Term

Sequenz: CRQLIDIVDQ LKNYVNDLVP EFLPAPEDVE

Kreuzreaktivität: Human

Kreuzreaktivität (Details): Calculated cross reactivity: Hu

Produktmerkmale: Interleukin 21 (IL-21), NT

Aufreinigung: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide CRQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to N-terminus of human IL-21.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide before the addition of 40 % glycerol.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu IL-21

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Andere Bezeichnung: Interleukin 21

Pathways: JAK-STAT Signalweg, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response