beta Endorphin Antikörper (AA 1-31)

Produktnummer ABIN2259672

Der Kaninchen Polyklonal anti-beta Endorphin Antikörper (ABIN2259672) detektiert spezifisch beta Endorphin in IHC, IF und RIA. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für beta Endorphin Antikörper (AA 1-31) (ABIN2259672)

Target: beta Endorphin (beta-EP) (Endorphin beta (beta-EP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser beta Endorphin Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Immunofluorescence (IF), Radioimmunoassay (RIA)

Produktdetails anti-beta Endorphin Antikörper

Bindungsspezifität: AA 1-31

Sequenz: YGGFMTSEKS QTPLVTLFKN AIIKNAYKKG E

Kreuzreaktivität: Human, Maus, Ratte (Rattus)

Kreuzreaktivität (Details): Calculated cross reactivity: Hu Mo Rt

Produktmerkmale: Endorphin, beta (B-Endorphin, Pro-opiomelanocortin, POMC)

Aufreinigung: Purified

Immunogen: Synthetic human beta-endorphin peptide corresponding to aa1-31, conjugated to BSA. Sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Anwendungsinformationen

Applikationshinweise: Optimal working conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Reconstitute with 500 μL PBS, pH 7.4.

Buffer: Supplied as a lyophilized powder in BSA.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu beta Endorphin

Target: beta Endorphin (beta-EP) (Endorphin beta (beta-EP))

Andere Bezeichnung: Endorphin, beta

UniProt: P01189

Pathways: Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity