Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

beta 2 Defensin Antikörper (AA 4-41)

Der Maus Monoklonal Anti-beta 2 Defensin-Antikörper wurde für WB, IHC (p) und EIA validiert. Er ist geeignet, beta 2 Defensin in Proben von Human zu detektieren. Es ist 1 Publikation verfügbar.
Produktnummer ABIN191997

Kurzübersicht für beta 2 Defensin Antikörper (AA 4-41) (ABIN191997)

Target

Alle beta 2 Defensin (BD-2) Antikörper anzeigen
beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Reaktivität

  • 36
  • 32
  • 18
  • 5
  • 2
  • 2
  • 1
Human

Wirt

  • 62
  • 13
  • 4
  • 2
Maus

Klonalität

  • 67
  • 13
Monoklonal

Konjugat

  • 30
  • 7
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
Dieser beta 2 Defensin Antikörper ist unkonjugiert

Applikation

  • 42
  • 39
  • 39
  • 20
  • 17
  • 16
  • 14
  • 11
  • 10
  • 4
  • 4
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Enzyme Immunoassay (EIA)

Klon

L12-4C-C2
  • Bindungsspezifität

    • 32
    • 17
    • 9
    • 2
    • 1
    AA 4-41

    Spezifität

    This antibody recognizes Human beta-Defensin 2 (aa 4-41).

    Produktmerkmale

    Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A

    Aufreinigung

    Protein G Chromatography

    Immunogen

    Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

    Isotyp

    IgG1
  • Applikationshinweise

    ELISA.
    Other applications not tested.
    Optimal dilutions are dependent on conditions and should be determined by the user.

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Rekonstitution

    Restore in 0.1 mL aqua bidest to 1 mg/mL.

    Buffer

    50 mM TRIS pH 7.4

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
    Shelf life: One year from despatch.

    Haltbarkeit

    12 months
  • Desmet, Van Gele, Grine, Remaut, Lambert: "Towards the development of a RNAi-based topical treatment for psoriasis: Proof-of-concept in a 3D psoriasis skin model." in: Experimental dermatology, (2018) (PubMed).

  • Target

    beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

    Andere Bezeichnung

    Defensin beta 2

    Hintergrund

    This antibiotic peptide is locally regulated by inflammation. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence.Synonyms: BD-2, Beta-defensin 2, Beta-defensin 4A, DEFB102, DEFB2, DEFB4A, DEFB4B, Skin-antimicrobial peptide 1, hBD-2

    Gen-ID

    100289462

    UniProt

    O15263
Sie sind hier:
Chat with us!