NPPB Antikörper (N-Term)

Produktnummer ABIN191931

Der Maus Monoklonal Anti-NPPB-Antikörper wurde für EIA validiert. Er ist geeignet, NPPB in Proben von Human zu detektieren.

Kurzübersicht für NPPB Antikörper (N-Term) (ABIN191931)

Target: NPPB (Natriuretic Peptides B (NPPB))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser NPPB Antikörper ist unkonjugiert

Applikation: Enzyme Immunoassay (EIA)

Klon: 01-03-21

Produktdetails anti-NPPB Antikörper

Bindungsspezifität: AA 1-32, N-Term

Spezifität: This antibody detects synthetic BNP (aa 1-32) and recombinant proBNP (aa 1-108).

Aufreinigung: Protein G chromatography

Immunogen: Synthetic human BNP (aa 1-32) KLH conjugatedAA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS pH 7,4

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch.

Haltbarkeit: 12 months

Details zu NPPB

Target: NPPB (Natriuretic Peptides B (NPPB))

Andere Bezeichnung: Natriuretic Peptides B

Hintergrund: In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134 amino acid precursor (prepro-BNP), which is cleaved by proteases to form a 26 aa "signal" peptide and a 108 aa pro-BNP. Proteolytic digestion of pro-BNP results in formation of 76 aa amino-terminal NT-proBNP and biologically active 32 aa BNP hormone molecule. Both proBNP and NTproBNP circulate in human plasma and have been proposed as markers for early diagnosis of left ventricular dysfunction as well as prognostic markers of possible cardiac complications at patients with heart failure.

Gen-ID: 4879

UniProt: P16860

Pathways: Hormone Activity