IL-21 Antikörper (AA 40-68)

Produktnummer ABIN1819420

Produktdetails anti-IL-21 Antikörper

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Bindungsspezifität: AA 40-68

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser IL-21 Antikörper ist unkonjugiert

Applikation: ELISA

Spezifität: Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Is suitable for use in immunocytochemistry on human spleen or tonsil cells.

Aufreinigung: Affinity purified

Immunogen: Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%), Gibbon, Monkey, Marmoset (97%), Sheep, Bovine, Horse (93%), Elephant, Dog (90%), Panda, Cat, Pig (83%).

Type of Immunogen: Synthetic peptide

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: ELISA (1:100000)

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS, 0.09 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20°C. Avoid freeze-thaw cycles.

Details zu IL-21

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Andere Bezeichnung: IL21 (IL21 Produkte)

Synonyme: IL-21 antikoerper, Za11 antikoerper, interleukin 21 antikoerper, IL21 antikoerper, Il21 antikoerper

Hintergrund: Name/Gene ID: IL21
Family: Interleukin

Synonyms: IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21

Gen-ID: 59067

UniProt: Q9HBE4

Pathways: JAK-STAT Signalweg, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response