SRA1 Antikörper (AA 519-556)

Produktnummer ABIN1742561

Der Maus Monoklonal Anti-SRA1-Antikörper wurde für WB, ELISA und IP validiert. Er ist geeignet, SRA1 in Proben von Human, Ratte und Maus zu detektieren. Es sind 2+ Publikationen verfügbar.

Kurzübersicht für SRA1 Antikörper (AA 519-556) (ABIN1742561)

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Reaktivität: Human, Ratte, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser SRA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Immunoprecipitation (IP)

Klon: 30A4

Produktdetails anti-SRA1 Antikörper

Bindungsspezifität: AA 519-556

Spezifität: Specific for Sra 1

Kreuzreaktivität (Details): may cross-react with CYFIP 2/PIR 121 due to high sequence homology.

Immunogen: Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: WB: 1:100 up to 1:2000, ICC: not recommended IHC: not recommended

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: For reconstitution add 100µl H2O to get a 1mg/ml solution in PBS.

Buffer: PBS. Azide was added before lyophilization.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Do not freeze! Antibodies should be stored at +4°C when still lyophilized.

Lagerung: -20 °C

Informationen zur Lagerung: Reconstitute and aliquot and store at -20°C to -80°C until use. Antibodies should be stored at +4°C when still lyophilized.

Referenzen für anti-SRA1 Antikörper (ABIN1742561)

Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." in: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." in: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).

Details zu SRA1

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Andere Bezeichnung: Sra 1

Hintergrund: Synonyms: CYFIP 1

Pathways: EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development