SRA1 Antikörper (AA 519-556)

Produktnummer ABIN1742561

Der Maus Monoklonal Anti-SRA1-Antikörper wurde für WB, ELISA und IP validiert. Er ist geeignet, SRA1 in Proben von Human, Ratte und Maus zu detektieren. Es sind 2+ Publikationen verfügbar.

Kurzübersicht für SRA1 Antikörper (AA 519-556) (ABIN1742561)

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Reaktivität: Human, Ratte, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser SRA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Immunoprecipitation (IP)

Klon: 30A4

Produktdetails anti-SRA1 Antikörper

Bindungsspezifität: AA 519-556

Spezifität: Specific for Sra 1

Kreuzreaktivität (Details): may cross-react with CYFIP 2/PIR 121 due to high sequence homology.

Aufreinigung: purified IgG. Azide was added before lyophilization.

Immunogen: Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: WB: 1 : 100 up to 1 : 2000 (AP staining)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: For reconstitution add 100 µL H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20 °C until use.

Buffer: PBS, 0.02% sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Do not store diluted antibody solutions unless you add detergent or carrier proteins such as goat serum, BSA or others. IgG sticks to glass and plastic. Any IgG solution below 0.1 mg/mL protein will quickly adsorb and denature and thus loose activity! Repetitive freeze-thawing of dilute purified IgG is almost certain to lead to substantial losses.

Lagerung: -20 °C

Informationen zur Lagerung: Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.

Referenzen für anti-SRA1 Antikörper (ABIN1742561)

Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." in: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." in: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).

Details zu SRA1

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Andere Bezeichnung: Sra 1

Hintergrund: Synonyms: CYFIP 1

Pathways: EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development