ACBD4 Antikörper (N-Term)

Produktnummer ABIN1105203

Produktdetails anti-ACBD4 Antikörper

Target: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Xenopus laevis, Huhn

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACBD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Sequenz: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT

Kreuzreaktivität (Details): Species reactivity (expected):Mouse, Rat, Bovine, Dog, African clawed frog, Zebrafish, ChickenSpecies reactivity (tested):Human

Aufreinigung: Purified using peptide immunoaffinity column

Immunogen: Synthetic peptide directed towards the N terminal of human ACBD4

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Rekonstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Details zu ACBD4

Target: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Andere Bezeichnung: ACBD4 (ACBD4 Produkte)

Synonyme: zgc:85611 antikoerper, F22F7.13 antikoerper, F22F7_13 antikoerper, acyl-CoA binding protein 4 antikoerper, 2010009P05Rik antikoerper, 2010015A21Rik antikoerper, AI849317 antikoerper, acyl-CoA binding domain containing 4 antikoerper, acyl-CoA binding protein 4 antikoerper, acyl-Coenzyme A binding domain containing 4 antikoerper, ACBD4 antikoerper, acbd4 antikoerper, Acbd4 antikoerper, ACBP4 antikoerper

Hintergrund: ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.Synonyms: Acyl-CoA-binding domain-containing protein 4, HMFT0700

Gen-ID: 79777

NCBI Accession: NP_078998