Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635315
Antigen
Epitop
N-Term
8
7
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
47
28
27
8
7
4
4
4
3
3
2
2
2
1
Wirt
Kaninchen
44
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
27
14
13
6
3
1
Optionen
Immunogen ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
Spezifität ACBD4 antibody was raised against the N terminal of ACBD4
Reinigung Affinity purified
Antigen
Andere Bezeichnung ACBD4 (ACBD4 Antibody Abstract)
Hintergrund ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.
Molekulargewicht 35 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ACBD4 Blocking Peptide, catalog no. 33R-6881, is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) antibody (ABIN635315) ACBD4 antibody used at 1 ug/ml to detect target protein.