ACBD4 Antikörper (N-Term)
-
- Target Alle ACBD4 Antikörper anzeigen
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Xenopus laevis, Huhn
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACBD4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Sequenz
- MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT
- Kreuzreaktivität (Details)
- Species reactivity (expected):Mouse, Rat, Bovine, Dog, African clawed frog, Zebrafish, ChickenSpecies reactivity (tested):Human
- Aufreinigung
- Purified using peptide immunoaffinity column
- Immunogen
- Synthetic peptide directed towards the N terminal of human ACBD4
- Top Product
- Discover our top product ACBD4 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
- Andere Bezeichnung
- ACBD4 (ACBD4 Produkte)
- Hintergrund
- ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.Synonyms: Acyl-CoA-binding domain-containing protein 4, HMFT0700
- Gen-ID
- 79777
- NCBI Accession
- NP_078998
-