AP2M1 Protein (AA 1-435, full length) (GST tag)

Produktnummer ABIN7479588

Recombinant AP2M1-Protein exprimiert in Escherichia coli (E. coli).

Kurzübersicht für AP2M1 Protein (AA 1-435, full length) (GST tag) (ABIN7479588)

Target: AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))

Protein-Typ: Recombinant

Spezies: Human

Quelle: Escherichia coli (E. coli)

Applikation: SDS-PAGE (SDS), ELISA, Western Blotting (WB)

Reinheit: 95 %

Produktdetails

Proteineigenschaft: AA 1-435, full length

Aufreinigungstag / Konjugat: Dieses AP2M1 Protein ist gelabelt mit GST tag.

Sequenz: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHAR QQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFE FLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIG WRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRV VMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKI EVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK VRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Anwendungsinformationen

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 6M guanidine hydrochloride, 20mM Tris

Lagerung: 4 °C

Antigendetails

Target: AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))

Andere Bezeichnung: AP-2 complex subunit mu

Hintergrund: Background: Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 mu subunit binds to transmembrane cargo proteins, it recognizes the Y-X-X-Phi motifs. The surface region interacting with to the Y-X-X-Phi motif is inaccessible in cytosolic AP-2, but becomes accessible through a conformational change following phosphorylation of AP-2 mu subunit at 'Tyr-156' in membrane-associated AP-2. The membrane-specific phosphorylation event appears to involve assembled clathrin which activates the AP-2 mu kinase AAK1 By similarity. Plays a role in endocytosis of frizzled family members upon Wnt signaling. Synonyms: Alternative name(s): AP-2 mu chain Adapter-related protein complex 2 mu subunit Adaptin-mu2 Adaptor protein complex AP-2 subunit mu Clathrin assembly protein complex 2 medium chain Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 HA2 50 kDa subunit Plasma membrane adaptor AP-2 50 kDa protein.

Molekulargewicht: 77 kD

NCBI Accession: NM_004068

UniProt: Q96CW1

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, EGFR Downregulation, SARS-CoV-2 Protein Interaktom