SLC5A8 Antikörper

Produktnummer ABIN635945

Der Kaninchen Polyklonal anti-SLC5A8 Antikörper wird verwendet zum Nachweis von SLC5A8 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SLC5A8 Antikörper (ABIN635945)

Target: SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC5A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC5A8 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC5 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC5A8 Blocking Peptide, (ABIN938723), is also available for use as a blocking control in assays to test for specificity of this SLC5A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC5A8

Target: SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))

Andere Bezeichnung: SLC5A8

Hintergrund: SLC5A8 has been shown to transport iodide by a passive mechanism and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism.

Molekulargewicht: 66 kDa (MW of target protein)