In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

KIAA1324 (KIAA1324) Antikörper

Antigen

KIAA1324 (KIAA1324)

Synonyme EIG121, MGC150624, RP11-352P4.1, BB183350, KIAA1324, mKIAA1324
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN635280
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung KIAA1324
Immunogen KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW
Beschreibung KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.
Molekulargewicht 111 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1324 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternativen

Alternativen zu Antigen "KIAA1324 (KIAA1324)", Typ "Antikörper" finden
Wirte Kaninchen (1)
Reaktivitäten Rind (Kuh) (1), Human (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (1)