ALDH6A1 Antikörper (Middle Region)

Produktnummer ABIN635062

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ALDH6A1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ALDH6A1 Antikörper (Middle Region) (ABIN635062)

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH6A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALDH6A1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ALDH6 A1 antibody was raised against the middle region of ALDH6 1

Aufreinigung: Affinity purified

Immunogen: ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH6A1 Blocking Peptide, (ABIN936992), is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH6A1

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Andere Bezeichnung: ALDH6A1

Hintergrund: This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation