ALDH6A1 Antikörper (Middle Region)

Produktnummer ABIN635061

Der Kaninchen Polyklonal anti-ALDH6A1 Antikörper (ABIN635061) detektiert spezifisch ALDH6A1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für ALDH6A1 Antikörper (Middle Region) (ABIN635061)

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH6A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALDH6A1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ALDH6 A1 antibody was raised against the middle region of ALDH6 1

Aufreinigung: Affinity purified

Immunogen: ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH6A1 Blocking Peptide, (ABIN938904), is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH6A1

Target: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Andere Bezeichnung: ALDH6A1

Hintergrund: ALDH6A1 plays a role in valine and pyrimidine metabolism. ALDH6A1 binds fatty acyl-CoA. This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation