AGT Antikörper

Produktnummer ABIN634787

Der Kaninchen Polyklonal anti-AGT Antikörper wird verwendet zum Nachweis von AGT in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für AGT Antikörper (ABIN634787)

Target: AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AGT Antikörper

Aufreinigung: Affinity purified

Immunogen: AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGT Blocking Peptide, (ABIN939371), is also available for use as a blocking control in assays to test for specificity of this AGT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGT

Target: AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))

Andere Bezeichnung: AGT

Hintergrund: AGT, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, ACE Inhibitor Pathway, EGFR Signaling Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Regulation of Lipid Metabolism by PPARalpha, Protein targeting to Nucleus, Feeding Behaviour, Monocarboxylic Acid Catabolic Process, Dicarboxylic Acid Transport, Positive Regulation of Response to DNA Damage Stimulus, Regulation of long-term Neuronal Synaptic Plasticity