POLB Antikörper

Produktnummer ABIN634154

Der Kaninchen Polyklonal anti-POLB Antikörper wird verwendet zum Nachweis von POLB in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für POLB Antikörper (ABIN634154)

Target: POLB (Polymerase (DNA Directed), beta (POLB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-POLB Antikörper

Aufreinigung: Affinity purified

Immunogen: POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLB Blocking Peptide, (ABIN938868), is also available for use as a blocking control in assays to test for specificity of this POLB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLB

Target: POLB (Polymerase (DNA Directed), beta (POLB))

Andere Bezeichnung: POLB

Hintergrund: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: DNA Reparatur