POLD2 Antikörper

Produktnummer ABIN634094

Der Kaninchen Polyklonal anti-POLD2 Antikörper wird verwendet zum Nachweis von POLD2 in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für POLD2 Antikörper (ABIN634094)

Target: POLD2 (Polymerase (DNA Directed), delta 2, Accessory Subunit (POLD2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-POLD2 Antikörper

Aufreinigung: Affinity purified

Immunogen: POLD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLD2 Blocking Peptide, (ABIN5615454), is also available for use as a blocking control in assays to test for specificity of this POLD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLD2

Target: POLD2 (Polymerase (DNA Directed), delta 2, Accessory Subunit (POLD2))

Andere Bezeichnung: POLD2

Hintergrund: This protein is a DNA polymerase delta complex, it is involved in DNA replication and repair.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA