KCNN2 Antikörper (Middle Region)

Produktnummer ABIN633679

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch KCNN2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für KCNN2 Antikörper (Middle Region) (ABIN633679)

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNN2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KCNN2 antibody was raised against the middle region of KCNN2

Aufreinigung: Affinity purified

Immunogen: KCNN2 antibody was raised using the middle region of KCNN2 corresponding to a region with amino acids KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNN2 Blocking Peptide, (ABIN939950), is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNN2

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Andere Bezeichnung: KCNN2

Hintergrund: KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.

Molekulargewicht: 26 kDa (MW of target protein)