IRAK3 Antikörper (C-Term)

Produktnummer ABIN633596

Der Kaninchen Polyklonal anti-IRAK3 Antikörper wird verwendet zum Nachweis von IRAK3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für IRAK3 Antikörper (C-Term) (ABIN633596)

Target: IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IRAK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IRAK3 Antikörper

Bindungsspezifität: C-Term

Spezifität: IRAK3 antibody was raised against the C terminal of IRAK3

Aufreinigung: Affinity purified

Immunogen: IRAK3 antibody was raised using the C terminal of IRAK3 corresponding to a region with amino acids NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IRAK3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this IRAK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRAK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IRAK3

Target: IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))

Andere Bezeichnung: IRAK3

Hintergrund: IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: TLR Signalweg, Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades