Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) Antikörper

Antigen: Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1)

Synonyme: STAU, FLJ25010, fi67e05, zgc:77271, wu:fi67e05, STAU1, DKFZp459A0124, CG5753, DmelCG5753, Dmstau, dStau, Stau, Stauf, stau, XStau, XStau1, Staufen, Staufen1, MGC145034

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN633583

Produktbeschreibung

Weitere Bezeichnung: STAU1

Immunogen: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK

Beschreibung: STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures.

Molekulargewicht: 35 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STAU1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.