Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) Antikörper

Antigen: Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1)

Synonyme: STAU, FLJ25010, fi67e05, zgc:77271, wu:fi67e05, STAU1, DKFZp459A0124, CG5753, DmelCG5753, Dmstau, dStau, Stau, Stauf, stau, XStau, XStau1, Staufen, Staufen1, MGC145034

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN633486

Produktbeschreibung

Weitere Bezeichnung: STAU1

Immunogen: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG

Beschreibung: This protein is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation.

Molekulargewicht: 63 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STAU1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.