RALB Antikörper

Produktnummer ABIN632601

Der Kaninchen Polyklonal anti-RALB Antikörper (ABIN632601) detektiert spezifisch RALB in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für RALB Antikörper (ABIN632601)

Target: RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RALB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RALB Antikörper

Aufreinigung: Affinity purified

Immunogen: RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RALB Blocking Peptide, (ABIN938430), is also available for use as a blocking control in assays to test for specificity of this RALB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RALB

Target: RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))

Andere Bezeichnung: RALB

Hintergrund: This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, CXCR4-mediated Signaling Events