FECH Antikörper

Produktnummer ABIN631196

Der Kaninchen Polyklonal anti-FECH Antikörper wird verwendet zum Nachweis von FECH in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für FECH Antikörper (ABIN631196)

Target: FECH (Ferrochelatase (FECH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FECH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FECH Antikörper

Aufreinigung: Affinity purified

Immunogen: FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids KRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FECH Blocking Peptide, (ABIN940022), is also available for use as a blocking control in assays to test for specificity of this FECH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FECH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FECH

Target: FECH (Ferrochelatase (FECH))

Andere Bezeichnung: FECH

Hintergrund: FECH is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis