ABAT Antikörper (Middle Region)

Produktnummer ABIN631182

Der Kaninchen Polyklonal anti-ABAT Antikörper (ABIN631182) detektiert spezifisch ABAT in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ABAT Antikörper (Middle Region) (ABIN631182)

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABAT Antikörper

Bindungsspezifität: Middle Region

Spezifität: ABAT antibody was raised against the middle region of ABAT

Aufreinigung: Affinity purified

Immunogen: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABAT Blocking Peptide, (ABIN936206), is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABAT

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Andere Bezeichnung: ABAT

Hintergrund: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process