IDH2 Antikörper

Produktnummer ABIN631096

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch IDH2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für IDH2 Antikörper (ABIN631096)

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IDH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IDH2 Antikörper

Aufreinigung: Affinity purified

Immunogen: IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IDH2 Blocking Peptide, (ABIN938690), is also available for use as a blocking control in assays to test for specificity of this IDH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IDH2

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Andere Bezeichnung: IDH2

Hintergrund: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Warburg Effekt