IDH1 Antikörper

Produktnummer ABIN631068

Der Kaninchen Polyklonal anti-IDH1 Antikörper (ABIN631068) detektiert spezifisch IDH1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für IDH1 Antikörper (ABIN631068)

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IDH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IDH1 Antikörper

Aufreinigung: Affinity purified

Immunogen: IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IDH1 Blocking Peptide, (ABIN5614132), is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IDH1

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Andere Bezeichnung: IDH1

Hintergrund: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Warburg Effekt