ABAT Antikörper (Middle Region)

Produktnummer ABIN630787

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ABAT in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ABAT Antikörper (Middle Region) (ABIN630787)

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABAT Antikörper

Bindungsspezifität: Middle Region

Spezifität: ABAT antibody was raised against the middle region of ABAT

Aufreinigung: Affinity purified

Immunogen: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABAT Blocking Peptide, (ABIN939395), is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABAT

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Andere Bezeichnung: ABAT

Hintergrund: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process