DKK1 Antikörper

Produktnummer ABIN630289

Produktdetails anti-DKK1 Antikörper

Target: DKK1 (Dickkopf Homolog 1 (DKK1))

Reaktivität: Human, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DKK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DKK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DKK1 Blocking Peptide, catalog no. 33R-1645, is also available for use as a blocking control in assays to test for specificity of this DKK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DKK1

Target: DKK1 (Dickkopf Homolog 1 (DKK1))

Andere Bezeichnung: DKK1 (DKK1 Produkte)

Hintergrund: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: WNT Signalweg, Regulation of Muscle Cell Differentiation, Positive Regulation of fat Cell Differentiation