FAH Antikörper

Produktnummer ABIN629635

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch FAH in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für FAH Antikörper (ABIN629635)

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-FAH Antikörper

Aufreinigung: Purified

Immunogen: FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAH Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FAH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAH

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Andere Bezeichnung: FAH

Hintergrund: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Molekulargewicht: 46 kDa (MW of target protein)