GFP Protein (AA 1-238) (His tag)
-
- Target Alle GFP Proteine anzeigen
- GFP (Green Fluorescent Protein (GFP))
- Protein-Typ
- Recombinant
- Proteineigenschaft
- AA 1-238
- Spezies
- Aequorea victoria
-
Quelle
- Escherichia coli (E. coli)
- Aufreinigungstag / Konjugat
- Dieses GFP Protein ist gelabelt mit His tag.
- Applikation
- SDS-PAGE (SDS), Western Blotting (WB), Positive Control (PC), Immunogen (Imm)
- Sequenz
- S-Met1-Lys238-TRTRPLEQKL ISEEDLAAND ILDYKDDDDK V
- Produktmerkmale
- Recombinant Green Fluorescent Protein (GFP), Prokaryotic expression, S-Met1-Lys238myc-FLAG tag, N-terminal His Tag
- Reinheit
- > 90 %
- Top Product
- Discover our top product GFP Protein
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Isoelectric Point:5.1
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- PBS, pH7.4, containing 20% Glycerine
- Lagerung
- 4 °C,-80 °C
- Informationen zur Lagerung
- Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
- Haltbarkeit
- 12 months
-
- Target
- GFP (Green Fluorescent Protein (GFP))
- Andere Bezeichnung
- Green Fluorescent Protein (GFP Produkte)
- Molekulargewicht
- 37kDa
-