YES1 Antikörper

Produktnummer ABIN8115600

Der Kaninchen Polyklonal anti-YES1 Antikörper (ABIN8115600) detektiert spezifisch YES1 in IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Rind (Kuh), Meerschweinchen, Pferd und Kaninchen.

Kurzübersicht für YES1 Antikörper (ABIN8115600)

Target: YES1 (V-Yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1 (YES1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Rind (Kuh), Meerschweinchen, Pferd, Kaninchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser YES1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-YES1 Antikörper

Verwendungszweck: YES1 Antibody

Sequenz: EQVERGYRMP CPQGCPESLH ELMNLCWKKD PDERPTFEYI QSFLEDYFTA

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 93%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63762-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu YES1

Target: YES1 (V-Yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1 (YES1))

Andere Bezeichnung: YES1

Hintergrund:

Background Information: This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.

Gene Name: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1

Alternative Symbols: Yes, c-yes, HsT441, P61-YES

Protein Name: Tyrosine-protein kinase Yes

Molekulargewicht: 61 kDa

Gen-ID: 7525

NCBI Accession: NP_005424

UniProt: P07947

Pathways: CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Thromboxane A2 Receptor Signaling