STXBP2 Antikörper

Produktnummer ABIN8113314

Der Kaninchen Polyklonal anti-STXBP2 Antikörper (ABIN8113314) detektiert spezifisch STXBP2 in IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen und Zebrafisch (Danio rerio).

Kurzübersicht für STXBP2 Antikörper (ABIN8113314)

Target: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STXBP2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-STXBP2 Antikörper

Verwendungszweck: STXBP2 Antibody

Sequenz: CMKHFKGSVE KLCSVEQDLA MGSDAEGEKI KDSMKLIVPV LLDAAVPAYD

Homologie: Cow: 100%, Dog: 92%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 92%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64422-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu STXBP2

Target: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Andere Bezeichnung: STXBP2

Hintergrund:

Background Information: This gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Gene Name: syntaxin binding protein 2

Alternative Symbols: FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

Protein Name: Syntaxin-binding protein 2

Molekulargewicht: 66 kDa

Gen-ID: 6813

NCBI Accession: NP_008880

UniProt: Q15833

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis