NEU2 Antikörper

Produktnummer ABIN8111686

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NEU2 in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Ratte, Maus, Hund, Schwein, Rind (Kuh), Meerschweinchen und Kaninchen.

Kurzübersicht für NEU2 Antikörper (ABIN8111686)

Target: NEU2 (Sialidase 2 (Cytosolic Sialidase) (NEU2))

Reaktivität: Human, Ratte, Maus, Hund, Schwein, Rind (Kuh), Meerschweinchen, Kaninchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEU2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-NEU2 Antikörper

Verwendungszweck: NEU2 Antibody

Sequenz: SGAHAYRIPA LLYLPGQQSL LAFAEQRASK KDEHAELIVL RRGDYDAPTH

Homologie: Cow: 79%, Dog: 86%, Guinea Pig: 85%, Human: 100%, Mouse: 86%, Pig: 86%, Rabbit: 77%, Rat: 79%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64280-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu NEU2

Target: NEU2 (Sialidase 2 (Cytosolic Sialidase) (NEU2))

Andere Bezeichnung: NEU2

Hintergrund:

Background Information: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.

Gene Name: sialidase 2 (cytosolic sialidase)

Alternative Symbols: SIAL2

Protein Name: Sialidase-2

Molekulargewicht: 42 kDa

Gen-ID: 4759

NCBI Accession: NP_005374

UniProt: Q9Y3R4

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development