RICTOR Antikörper

Produktnummer ABIN8111026

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RICTOR in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Hund, Pferd, Kaninchen, Schwein und Rind (Kuh).

Kurzübersicht für RICTOR Antikörper (ABIN8111026)

Target: RICTOR (RPTOR Independent Companion of mTOR, Complex 2 (RICTOR))

Reaktivität: Human, Maus, Ratte, Hund, Pferd, Kaninchen, Schwein, Rind (Kuh)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RICTOR Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-RICTOR Antikörper

Verwendungszweck: RICTOR Antibody

Sequenz: GENDLKFTKN FGTENHRENT SRERLVVESS TSSHMKIRSQ SFNTDTTTSG

Homologie: Cow: 93%, Dog: 100%, Horse: 100%, Human: 100%, Mouse: 93%, Pig: 93%, Rabbit: 100%, Rat: 100%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61411-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu RICTOR

Target: RICTOR (RPTOR Independent Companion of mTOR, Complex 2 (RICTOR))

Andere Bezeichnung: RICTOR

Hintergrund:

Background Information: RICTOR and MTOR (FRAP1, MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008]

Gene Name: RPTOR independent companion of MTOR, complex 2

Alternative Symbols: PIA, AVO3, hAVO3

Protein Name: Rapamycin-insensitive companion of mTOR

Molekulargewicht: 192 kDa

Gen-ID: 253260

NCBI Accession: NP_689969

UniProt: Q6R327

Pathways: Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Actin Filament Polymerization, CXCR4-mediated Signaling Events