RHCG Antikörper

Produktnummer ABIN8110461

Der Kaninchen Polyklonal anti-RHCG Antikörper (ABIN8110461) detektiert spezifisch RHCG in IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Schaf und Zebrafisch (Danio rerio).

Kurzübersicht für RHCG Antikörper (ABIN8110461)

Target: RHCG (Rh Family C Glycoprotein (RHCG))

Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Schaf, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHCG Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-RHCG Antikörper

Verwendungszweck: RHCG Antibody

Sequenz: QSKERQNSVY QSDLFAMIGT LFLWMYWPSF NSAISYHGDS QHRAAINTYC

Homologie: Cow: 86%, Dog: 79%, Guinea Pig: 86%, Horse: 79%, Human: 100%, Mouse: 79%, Rat: 86%, Sheep: 86%, Zebrafish: 86%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP42465-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu RHCG

Target: RHCG (Rh Family C Glycoprotein (RHCG))

Andere Bezeichnung: RHCG

Hintergrund:

Gene Name: Rh family, C glycoprotein

Alternative Symbols: RHGK, PDRC2, C15orf6, SLC42A3

Protein Name: Ammonium transporter Rh type C

Molekulargewicht: 53 kDa

Gen-ID: 51458

NCBI Accession: NP_057405

UniProt: Q9UBD6