PLAC8 Antikörper

Produktnummer ABIN8108297

Der Kaninchen Polyklonal anti-PLAC8 Antikörper wird verwendet zum Nachweis von PLAC8 in Proben von Human und Rind (Kuh). Er wurde validiert für IHC.

Kurzübersicht für PLAC8 Antikörper (ABIN8108297)

Target: PLAC8 (Placenta-Specific 8 (PLAC8))

Reaktivität: Human, Rind (Kuh)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLAC8 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-PLAC8 Antikörper

Verwendungszweck: PLAC8 Antibody

Sequenz: AQAPVVVVTQ PGVGPGPAPQ NSNWQTGMCD CFSDCGVCLC GTFCFPCLGC

Homologie: Cow: 93%, Human: 100%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP47959-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu PLAC8

Target: PLAC8 (Placenta-Specific 8 (PLAC8))

Andere Bezeichnung: PLAC8

Hintergrund:

Gene Name: placenta-specific 8

Alternative Symbols: C15, DGIC, onzin, PNAS-144

Protein Name: Placenta-specific gene 8 protein

Molekulargewicht: 13 kDa

Gen-ID: 51316

NCBI Accession: NP_057703

UniProt: Q9NZF1

Pathways: Brown Fat Cell Differentiation