PCTP Antikörper

Produktnummer ABIN8107995

Der Kaninchen Polyklonal anti-PCTP Antikörper (ABIN8107995) detektiert spezifisch PCTP in IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte, Hund, Rind (Kuh), Meerschweinchen, Kaninchen und Pferd.

Kurzübersicht für PCTP Antikörper (ABIN8107995)

Target: PCTP (Phosphatidylcholine Transfer Protein (PCTP))

Reaktivität: Human, Ratte, Hund, Rind (Kuh), Meerschweinchen, Kaninchen, Pferd

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCTP Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-PCTP Antikörper

Verwendungszweck: PCTP Antibody

Sequenz: VLEDCSPTLL ADIYMDSDYR KQWDQYVKEL YEQECNGETV VYWEVKYPFP

Homologie: Cow: 86%, Dog: 93%, Guinea Pig: 86%, Horse: 77%, Human: 100%, Rabbit: 86%, Rat: 86%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64249-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu PCTP

Target: PCTP (Phosphatidylcholine Transfer Protein (PCTP))

Andere Bezeichnung: PCTP

Hintergrund:

Gene Name: phosphatidylcholine transfer protein

Alternative Symbols: PC-TP, STARD2

Protein Name: Phosphatidylcholine transfer protein

Molekulargewicht: 25 kDa

Gen-ID: 58488

NCBI Accession: NP_067036

UniProt: Q9UKL6