MSRB3 Antikörper

Produktnummer ABIN8105257

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MSRB3 in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Saccharomyces cerevisiae und Zebrafisch (Danio rerio).

Kurzübersicht für MSRB3 Antikörper (ABIN8105257)

Target: MSRB3 (Methionine Sulfoxide Reductase B3 (MSRB3))

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Saccharomyces cerevisiae, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSRB3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-MSRB3 Antikörper

Verwendungszweck: MSRB3 Antibody

Sequenz: ESAFEGEYTH HKDPGIYKCV VCGTPLFKSE TKFDSGSGWP SFHDVINSEA

Homologie: Cow: 100%, Dog: 86%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Yeast: 79%, Zebrafish: 86%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61892-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu MSRB3

Target: MSRB3 (Methionine Sulfoxide Reductase B3 (MSRB3))

Andere Bezeichnung: MSRB3

Hintergrund:

Background Information: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.

Gene Name: methionine sulfoxide reductase B3

Alternative Symbols: DFNB74

Protein Name: Methionine-R-sulfoxide reductase B3

Molekulargewicht: 21 kDa

Gen-ID: 253827

NCBI Accession: NP_932346

UniProt: Q8IXL7