GnRH2 Antikörper

Produktnummer ABIN8101864

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GnRH2 in IHC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für GnRH2 Antikörper (ABIN8101864)

Target: GnRH2 (Gonadotropin-Releasing Hormone 2 (GnRH2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GnRH2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-GnRH2 Antikörper

Verwendungszweck: GNRH2 Antibody

Sequenz: SDALAPLDDS MPWEGRTTAQ WSLHRKRHLA RTLLTAAREP RPAPPSSNKV

Homologie: Human: 100%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP55770-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu GnRH2

Target: GnRH2 (Gonadotropin-Releasing Hormone 2 (GnRH2))

Andere Bezeichnung: GNRH2

Hintergrund:

Background Information: The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene.

Gene Name: gonadotropin-releasing hormone 2

Alternative Symbols: GnRH-II, LH-RHII

Protein Name: Progonadoliberin-2

Molekulargewicht: 13 kDa

Gen-ID: 2797

NCBI Accession: NP_847902

UniProt: O43555

Pathways: Hormone Activity