GCSH Antikörper

Produktnummer ABIN8101739

Der Kaninchen Polyklonal anti-GCSH Antikörper wird verwendet zum Nachweis von GCSH in Proben von Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen und Meerschweinchen. Er wurde validiert für IHC.

Kurzübersicht für GCSH Antikörper (ABIN8101739)

Target: GCSH (Glycine Cleavage System H Protein (GCSH))

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCSH Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-GCSH Antikörper

Verwendungszweck: GCSH Antibody

Sequenz: IGTVGISNFA QEALGDVVYC SLPEVGTKLN KQDEFGALES VKAASELYSP

Homologie: Cow: 93%, Dog: 100%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 86%, Rabbit: 93%, Rat: 100%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64204-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu GCSH

Target: GCSH (Glycine Cleavage System H Protein (GCSH))

Andere Bezeichnung: GCSH

Hintergrund:

Background Information: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.

Gene Name: glycine cleavage system protein H (aminomethyl carrier)

Alternative Symbols: GCE, NKH

Protein Name: Glycine cleavage system H protein, mitochondrial

Molekulargewicht: 19 kDa

Gen-ID: 2653

NCBI Accession: NP_004474

UniProt: P23434