LGALS7 Antikörper

Produktnummer ABIN8101252

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch LGALS7 in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Hund, Schwein und Rind (Kuh).

Kurzübersicht für LGALS7 Antikörper (ABIN8101252)

Target: LGALS7 (Galectin 7 (LGALS7))

Reaktivität: Human, Maus, Ratte, Hund, Schwein, Rind (Kuh)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LGALS7 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-LGALS7 Antikörper

Verwendungszweck: LGALS7 Antibody

Sequenz: SRFHVNLLCG EEQGSDAALH FNPRLDTSEV VFNSKEQGSW GREERGPGVP

Homologie: Cow: 93%, Dog: 79%, Human: 100%, Mouse: 93%, Pig: 86%, Rat: 86%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64142-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu LGALS7

Target: LGALS7 (Galectin 7 (LGALS7))

Andere Bezeichnung: LGALS7

Hintergrund:

Background Information: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19.

Gene Name: lectin, galactoside-binding, soluble, 7

Alternative Symbols: GAL7, LGALS7A

Protein Name: Galectin-7

Molekulargewicht: 15 kDa

Gen-ID: 3963

NCBI Accession: NP_002298

UniProt: P47929