GALP Antikörper

Produktnummer ABIN8101248

Der Kaninchen Polyklonal anti-GALP Antikörper (ABIN8101248) detektiert spezifisch GALP in IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Schwein.

Kurzübersicht für GALP Antikörper (ABIN8101248)

Target: GALP (Galanin-Like Peptide (GALP))

Reaktivität: Human, Schwein

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALP Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-GALP Antikörper

Verwendungszweck: GALP Antibody

Sequenz: VLHLPQMGDQ DGKRETALEI LDLWKAIDGL PYSHPPQPSK RNVMETFAKP

Homologie: Human: 100%, Pig: 93%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63212-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu GALP

Target: GALP (Galanin-Like Peptide (GALP))

Andere Bezeichnung: GALP

Hintergrund:

Background Information: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors.

Gene Name: galanin-like peptide

Protein Name: Galanin-like peptide

Molekulargewicht: 13 kDa

Gen-ID: 85569

NCBI Accession: NP_149097

UniProt: Q9UBC7