FMN1 Antikörper

Produktnummer ABIN8100949

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch FMN1 in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Hund, Meerschweinchen, Pferd und Kaninchen.

Kurzübersicht für FMN1 Antikörper (ABIN8100949)

Target: FMN1 (Formin 1 (FMN1))

Reaktivität: Human, Maus, Hund, Meerschweinchen, Pferd, Kaninchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FMN1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-FMN1 Antikörper

Verwendungszweck: FMN1 Antibody

Sequenz: ASEKQMVVVC KESPKEYLQP FKDKLEEFFQ KAKKEHKMEE SHLENAQKSF

Homologie: Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 93%, Rabbit: 85%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSF

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61897-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu FMN1

Target: FMN1 (Formin 1 (FMN1))

Andere Bezeichnung: FMN1

Hintergrund:

Gene Name: formin 1

Alternative Symbols: LD, FMN

Protein Name: Formin-1

Molekulargewicht: 158 kDa

Gen-ID: 342184

NCBI Accession: NP_001096654

UniProt: Q68DA7

Pathways: Regulation of Actin Filament Polymerization