DUOXA2 Antikörper

Produktnummer ABIN8099231

Der Kaninchen Polyklonal anti-DUOXA2 Antikörper wird verwendet zum Nachweis von DUOXA2 in Proben von Human, Rind (Kuh), Hund, Meerschweinchen, Pferd, Maus, Kaninchen und Ratte. Er wurde validiert für IHC.

Kurzübersicht für DUOXA2 Antikörper (ABIN8099231)

Target: DUOXA2 (Dual Oxidase Maturation Factor 2 (DUOXA2))

Reaktivität: Human, Rind (Kuh), Hund, Meerschweinchen, Pferd, Maus, Kaninchen, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DUOXA2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-DUOXA2 Antikörper

Verwendungszweck: DUOXA2 Antibody

Sequenz: RWFWLVRVLL SLFIGAEIVA VHFSAEWFVG TVNTNTSYKA FSAARVTARV

Homologie: Cow: 86%, Dog: 86%, Guinea Pig: 86%, Horse: 86%, Human: 100%, Mouse: 86%, Rabbit: 86%, Rat: 86%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64802-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu DUOXA2

Target: DUOXA2 (Dual Oxidase Maturation Factor 2 (DUOXA2))

Andere Bezeichnung: DUOXA2

Hintergrund:

Background Information: This gene encodes an endoplasmic reticulum protein that is necessary for proper cellular localization and maturation of functional dual oxidase 2. Mutations in this gene have been associated with thyroid dyshormonogenesis 5.

Gene Name: dual oxidase maturation factor 2

Alternative Symbols: TDH5, SIMNIPHOM

Protein Name: Dual oxidase maturation factor 2

Molekulargewicht: 35 kDa

Gen-ID: 405753

NCBI Accession: NP_997464

UniProt: Q1HG44

Pathways: Thyroid Hormone Synthesis