Adrenomedullin 2 Antikörper

Produktnummer ABIN8094281

Der Kaninchen Polyklonal anti-Adrenomedullin 2 Antikörper wird verwendet zum Nachweis von Adrenomedullin 2 in Proben von Human, Ratte, Maus, Rind (Kuh), Pferd und Schwein. Er wurde validiert für IHC.

Kurzübersicht für Adrenomedullin 2 Antikörper (ABIN8094281)

Target: Adrenomedullin 2 (ADM2)

Reaktivität: Human, Ratte, Maus, Rind (Kuh), Pferd, Schwein

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adrenomedullin 2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-Adrenomedullin 2 Antikörper

Verwendungszweck: ADM2 Antibody

Sequenz: GPRRTQAQLL RVGCVLGTCQ VQNLSHRLWQ LMGPAGRQDS APVDPSSPHS

Homologie: Cow: 100%, Horse: 100%, Human: 100%, Mouse: 93%, Pig: 83%, Rat: 93%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64721-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu Adrenomedullin 2

Target: Adrenomedullin 2 (ADM2)

Andere Bezeichnung: ADM2

Hintergrund:

Background Information: This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues, acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Gene Name: adrenomedullin 2

Alternative Symbols: AM2, dJ579N16.4

Protein Name: ADM2

Molekulargewicht: 16 kDa

Gen-ID: 79924

NCBI Accession: NP_079142

UniProt: Q7Z4H4

Pathways: Hormone Activity, Feeding Behaviour