AICDA Antikörper (N-Term)

Produktnummer ABIN8093920

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch AICDA in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Kaninchen, Hund, Rind (Kuh), Schwein, Meerschweinchen und Pferd.

Kurzübersicht für AICDA Antikörper (N-Term) (ABIN8093920)

Target: AICDA (Activation-Induced Cytidine Deaminase (AICDA))

Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Rind (Kuh), Schwein, Meerschweinchen, Pferd

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AICDA Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-AICDA Antikörper

Bindungsspezifität: N-Term

Verwendungszweck: AICDA Antibody N-terminal region

Sequenz: VKRRDSATSF SLDFGYLRNK NGCHVELLFL RYISDWDLDP GRCYRVTWFT

Homologie: Cow: 93%, Dog: 100%, Guinea Pig: 93%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 100%, Rabbit: 100%, Rat: 100%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63254-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu AICDA

Target: AICDA (Activation-Induced Cytidine Deaminase (AICDA))

Andere Bezeichnung: AICDA

Hintergrund:

Background Information: This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).

Gene Name: activation-induced cytidine deaminase

Alternative Symbols: AID, ARP2, CDA2, HIGM2, HEL-S-284

Protein Name: Activation-induced cytidine deaminase

Molekulargewicht: 24 kDa

Gen-ID: 57379

NCBI Accession: NP_065712

UniProt: Q9GZX7

Pathways: Cellular Response to Molecule of Bacterial Origin, Regulation of Actin Filament Polymerization, Production of Molecular Mediator of Immune Response